Protein coding transcript 24082

• Transcript: Ll_transcript_390728
• CDS coordinates: 2-391 (+)
• Peptide sequence: LYLNSLFQALSVFLLYVRCSAIDPSDLGLFDDSDKTSKNTSIRDGEFTEPKIGLKGEGMSERHTSIWCSKLGCFFCSLLVREDCRSNEGVISHQQSGELQDNLFCTLCNAEVNKFSKHCRSCDKCVDGFG
• ORF Type: internal

Annotations of Ll_transcript_390728

• Blastp: Protein S-acyltransferase 21 from Arabidopsis with 47.97% of identity
• Blastx: Protein S-acyltransferase 21 from Arabidopsis with 47.97% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT2G33640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438127.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;