Protein coding transcript 240853

• Transcript: Ll_transcript_258405
• CDS coordinates: 1531-1869 (+)
• Peptide sequence: MDGDILNCLNDLESQFSLPQTTLEMATVENLLHIPEDSVPCKIRAKRGCATHPRSIAERERRTRISGKLKKLQDLVPNMDKQTSYSDMLDLAVQHIKGLQSQVQTVHWGLLA*
• ORF Type: complete

Annotations of Ll_transcript_258405

• Blastp: Transcription factor bHLH129 from Arabidopsis with 84.95% of identity
• Blastx: Transcription factor bHLH128 from Arabidopsis with 61.88% of identity
• Eggnog: transcription factor(ENOG41108V5)
• Kegg: Link to kegg annotations (AT2G43140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451772.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;