Transcript | Ll_transcript_258428 |
---|---|
CDS coordinates | 388-1440 (+) |
Peptide sequence | MIVAMDLNASPVPDEEEDTFEGHAVREFIASEERVESAVDIARREREERKRRLKRERPDDRPVHVSQSPGYDQLFHTKTLKSHDKSRLPPGWLDCPSFGQEIYCMVPSKVPLGESFNDCIAPGKRYSFKQVIHQQRVLGRKLGLVIDLTNTSRYYPVTDLKKEGIKHVKIQCKGRDSVPDNLAVNQFVYEVTQFLVRQKHSKKYILVHCTHGHNRTGYMIIHYLMRSMSMSVTQAIKMFSDARPPGIYKPDYIDGLYTFYHEKKPEMVVCPPTPEWKRSSELDLNGEAIPDDDDDGIPDPHLPENHETDTRMTNDDVLGDEISNEQQEAFRQFCYQSLKLSSGARGHAQFP |
ORF Type | 3prime_partial |
Blastp | mRNA-capping enzyme from Homo with 39.2% of identity |
---|---|
Blastx | mRNA-capping enzyme from Homo with 38.76% of identity |
Eggnog | Second step of mRNA capping. Transfer of the GMP moiety of GTP to the 5'-end of RNA via an enzyme-GMP covalent reaction intermediate (By similarity)(COG5226) |
Kegg | Link to kegg annotations (8732) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432012.1) |
Pfam | Dual specificity phosphatase, catalytic domain (PF00782.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer