Protein coding transcript 240880

• Transcript: Ll_transcript_260538
• CDS coordinates: 3-872 (+)
• Peptide sequence: GTARLMFNSFGSSLWMMPFSKYCRADDKYWKHFSAEKHIGHHTYRCDERELQSNFSGWPTNVINIEIPTTREVTPANLSSMECGMPTQLSFTAREISDGSFFKAIEDYDPDSKRLLYQLEKSYLGDPILNPLTPWDRPPIKNVFCIYGTDSKTKVGYYFAPSGKPYPDNWIITDVVYELEGSLMSRSGNLVEGNPGATSGDETVPYHSLAWCKNWLGPKVNITRAPQVEHDGTDVQIKLNVEHQRHEDVVPNMTKSPKVKYITYYEDSESLPGKRTAVWELDKANHRNIV
• ORF Type: internal

Annotations of Ll_transcript_260538

• Blastp: Phospholipid--sterol O-acyltransferase from Arabidopsis with 70.31% of identity
• Blastx: Phospholipid--sterol O-acyltransferase from Arabidopsis with 70.31% of identity
• Eggnog: Acyl-transferase(ENOG410Y9CF)
• Kegg: Link to kegg annotations (AT1G04010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456706.1)
• Pfam: Lecithin:cholesterol acyltransferase (PF02450.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;