Transcript | Ll_transcript_428164 |
---|---|
CDS coordinates | 26-361 (+) |
Peptide sequence | MLQSVCTNLLFVITGYDSDELDTEMLPEIMQNVPAGASTKQMIHFGQLINSDKFRQYDHGMFNNLITYKSFSPPNYPLEKISTKVYLHYADNDLLATPTGVEKLIKRLTSVK |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | Lipase 3 from Sophophora with 38.79% of identity |
Eggnog | Alpha beta hydrolase(COG0596) |
Kegg | Link to kegg annotations (Dmel_CG8823) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020209765.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer