Transcript | Ll_transcript_258526 |
---|---|
CDS coordinates | 436-1338 (+) |
Peptide sequence | MGGVGDEEPALKRIKLSSIGLVPSSNVSSSKEPVRGSSSGFMARPVSSPEGDRQVIGSRGLIKREEFVRIISKALYSLGYRKSGEYLEEESGIPLHTSAVNMLMQHILDGNWDESVASLHKIGLEDESIVRSASFLILEQKFFELLDGEKVMEALKTLRTEIAPLRTNSRRIHELTYCIVSPSCKLNTIRVGSRSKLLEELQKLLPPTIMIPEKRLEYLVEQALISQRESCPFHNSSDKEISLYSDHHCGKDQIPSRTSQILEAHDDEVWFVQFSHNGKYLASASNDRSAIIWEVVFHLI* |
ORF Type | complete |
Blastp | WD repeat-containing protein 26 from Silurana with 33.23% of identity |
---|---|
Blastx | Uncharacterized WD repeat-containing protein C343.04c from Schizosaccharomyces with 27.97% of identity |
Eggnog | WD repeat domain 26(ENOG410XQ2U) |
Kegg | Link to kegg annotations (733878) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432015.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer