Protein coding transcript 24110

• Transcript: Ll_transcript_391825
• CDS coordinates: 108-1361 (+)
• Peptide sequence: MASSSIRLRRPLSAALSTFHRSLSTPIHRQHLTPNHYHLHVLQTPPPPPPQFQSTRAFRSSPISLLSTRPSSSNDEIGPDTILFEGCDYNHWLFVMDFPKDNKPSPEDMVRVYEDTCAKGLNISVEEAKKKMYACSTTTYTGFQAVMTEEESKKFESLPGVIFVLPDSYIDPVNKQYGGDQYINGTIIPRPPPVQYGRNQRRQDDRRGPGRYNQQGNQMSNPQENFSYNSRGPVQGDGRNYGPAQNYCQPQQNYGQPSQNFPPQQNYGQASQNYPPQQNYGQASQNYPPQQNHGQGSPNYTTHPQQQRHGPSSPQYAQQQNFVPSGQGERRSYVPQQHFGPPGQGERRDPATSPGGTGASQSWGDTSFTPSSVKDFKPSYMEEFGQANQGNYPPKEQAESQQRYPPPGQGNFTGQVW*
• ORF Type: complete

Annotations of Ll_transcript_391825

• Blastp: Multiple organellar RNA editing factor 1, mitochondrial from Arabidopsis with 46.46% of identity
• Blastx: Multiple organellar RNA editing factor 1, mitochondrial from Arabidopsis with 44.65% of identity
• Eggnog: NA(ENOG410ZPPQ)
• Kegg: Link to kegg annotations (AT4G20020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418462.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;