Transcript | Ll_transcript_257957 |
---|---|
CDS coordinates | 1739-2488 (+) |
Peptide sequence | MGFLKLLEVASVPVIQVLLIGALGAMMSTHYFDHLLSPDFRKSLNKVVFLVFTPSLVFASFAKSVSLADMISWWFMPVNVGLTFFIGGILGWILVKLLKPNLKVEGLIIASCSSGNMGNLPIVIVPAICDEKGGPFGRSDICHNNALSYASFSMALGGIFIWTYTYQTIRSRSMRYKALEAAQIVKIPNKDIDANAETLLLKGEYNQNIVAEVPTSDYIVDTENQSVRTYAILNYDGYILITCLSRSRF* |
ORF Type | complete |
Blastp | Protein PIN-LIKES 7 from Arabidopsis with 58.52% of identity |
---|---|
Blastx | Protein PIN-LIKES 7 from Arabidopsis with 58.52% of identity |
Eggnog | Auxin Efflux Carrier(COG0679) |
Kegg | Link to kegg annotations (AT5G65980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445160.1) |
Pfam | Membrane transport protein (PF03547.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer