Protein coding transcript 241162

• Transcript: Ll_transcript_259281
• CDS coordinates: 1-663 (+)
• Peptide sequence: VNWNDVAGLESAKQSLQEAVILPVKFPQFFTGKRRPWRAFLLYGPPGTGKSYLAKAVATEADSTFFSISSSDLVSKWMGESEKLVSNLFQMARDSAPSIIFIDEIDSLCGQRGEGNESEASRRIKTELLVQMQGVGNNDQKVLVLAATNTPYALDQAIRRRFDKRIYIPLPDVKARQHMFKVHLGDTPHNLTEGDFEHLARKTEGFSGSDVAVCVKDVLFE
• ORF Type: internal

Annotations of Ll_transcript_259281

• Blastp: Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 from Arabidopsis with 91.86% of identity
• Blastx: Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 from Arabidopsis with 91.86% of identity
• Eggnog: endosome to lysosome transport via multivesicular body sorting pathway(ENOG410XRHN)
• Kegg: Link to kegg annotations (AT2G27600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453883.1)
• Pfam: AAA domain (Cdc48 subfamily) (PF07724.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;