Protein coding transcript 241167

• Transcript: Ll_transcript_259297
• CDS coordinates: 1697-2026 (+)
• Peptide sequence: MGESEKLVSNLFQMARESAPSIIFIDEIDSLCGQRGEGNESEASRRIKTELLVQMQGVGNNDQKVLVLAATNTPYALDQAIRRRFDKRIYIPLPDVKARQHMFKARQYA*
• ORF Type: complete

Annotations of Ll_transcript_259297

• Blastp: Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 from Arabidopsis with 93.27% of identity
• Blastx: Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 from Arabidopsis with 77.26% of identity
• Eggnog: endosome to lysosome transport via multivesicular body sorting pathway(ENOG410XRHN)
• Kegg: Link to kegg annotations (AT2G27600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413549.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;