Transcript | Ll_transcript_259300 |
---|---|
CDS coordinates | 1993-2685 (+) |
Peptide sequence | MGESEKLVSNLFQMARDSAPSIIFIDEIDSLCGQRGEGNESEASRRIKTELLVQMQGVGNNDQKVLVLAATNTPYALDQAIRRRFDKRIYIPLPDVKARQHMFKVHLGDTPHNLTESDFEHLARKTDGFSGSDVAVCVKDVLFEPVRKTQDAMFFFQNHEGMWIPCGPKQQSSVQVTMQDLAAKGLASKILPPPITRTDFDKVLARQRPTVSKSDLDVHERFTKEFGEEG* |
ORF Type | complete |
Blastp | Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 from Arabidopsis with 86.09% of identity |
---|---|
Blastx | Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 from Arabidopsis with 85.65% of identity |
Eggnog | endosome to lysosome transport via multivesicular body sorting pathway(ENOG410XRHN) |
Kegg | Link to kegg annotations (AT2G27600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413549.1) |
Pfam | ATPase family associated with various cellular activities (AAA) (PF00004.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer