Protein coding transcript 241178

• Transcript: Ll_transcript_259286
• CDS coordinates: 176-484 (+)
• Peptide sequence: MFLPAFLTFEFFTSISSSDLVSKWMGESEKLVSNLFQMARDSAPSIIFIDEIDSLCGQRGEGNESEASRRIKTELLVQMQGVGNNDQKVLVLAATNTPYALDQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_259286

• Blastp: Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 from Arabidopsis with 91.3% of identity
• Blastx: Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 from Arabidopsis with 91.3% of identity
• Eggnog: endosome to lysosome transport via multivesicular body sorting pathway(ENOG410XRHN)
• Kegg: Link to kegg annotations (AT2G27600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453883.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;