Protein coding transcript 241199

• Transcript: Ll_transcript_259909
• CDS coordinates: 821-1594 (+)
• Peptide sequence: MLCIPQQTVEAVHSDICGSLFEKVVKEAIASGVDGYDADIKESVRKSAHGLRLTRETAMTIAGKAVRKIFINYIKRARAAGSRTESAKELKKMIAFNTLVVTELVEDIKGESADVSTEEPVKEVDITQTVDEDWDSLQTLKKIRPDKELIARMGKTGQTEITLKDDLPERDRTDLYKTYLLFCLTGEVKRVPFGAQITTKKDDSEYVLLNQLGGILGLTGKEIVEVHRGRAEQAFRQQAEVILADGQLTKARVEQLNN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_259909

• Blastp: Protein TIC110, chloroplastic from Arabidopsis with 73.93% of identity
• Blastx: Protein TIC110, chloroplastic from Arabidopsis with 73.82% of identity
• Eggnog: translocon at the inner envelope membrane of chloroplasts 110(ENOG410XRW7)
• Kegg: Link to kegg annotations (AT1G06950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461129.1)
• Pfam: Chloroplast envelope transporter (PF16940.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;