Transcript | Ll_transcript_259913 |
---|---|
CDS coordinates | 821-1723 (+) |
Peptide sequence | MLCIPQQTVEAVHSDICGSLFEKVVKEAIASGVDGYDADIKESVRKSAHGLRLTRKTAMSIASKAVRKIYINYIKRARAAGSRTESAKELKKMIAFNTLVVTELVEDIKGEPTDVSTEDPVKEEELAQTADEDWDSLQTLQKIRPDKELVAKLGKTGQTEITLKDDLPERDRTDLYKTYLLFCLTGEVKRVPFGAQITTKKDDSEYVLLNQLGGILGLSGKEIVEVHRSLAEQAFRQQAEVILADGQLTKARVEQLNNLQKQVGLPQEYAQKIIKSITTTKMAAAIETAVTQGRLNIKQIR |
ORF Type | 3prime_partial |
Blastp | Protein TIC110, chloroplastic from Arabidopsis with 75.83% of identity |
---|---|
Blastx | Protein TIC110, chloroplastic from Arabidopsis with 75.25% of identity |
Eggnog | translocon at the inner envelope membrane of chloroplasts 110(ENOG410XRW7) |
Kegg | Link to kegg annotations (AT1G06950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432221.1) |
Pfam | Chloroplast envelope transporter (PF16940.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer