Transcript | Ll_transcript_259828 |
---|---|
CDS coordinates | 555-1172 (+) |
Peptide sequence | MSALKKEISEYDDFLQLDIEEEYSKLPYKTLAFFKAAYALFDAEYYVKADDDIYLRPDRLSLLLAQERSHPQTYIGCMKKGSVVTDPNIKWYEPLSYLLGQEYFLHAYGPIYVLSADVVSSLVALRNDSFRMFSNEDVTIGAWMLAMNVEHEDNREICAPECSVTSIAVWDIPKCSGLCNPERKMLELHKKHMCSKTPTLAYDDD* |
ORF Type | complete |
Blastp | Probable beta-1,3-galactosyltransferase 14 from Arabidopsis with 78.54% of identity |
---|---|
Blastx | Probable beta-1,3-galactosyltransferase 14 from Arabidopsis with 77.43% of identity |
Eggnog | Beta-1,3-galactosyltransferase(ENOG410XV5H) |
Kegg | Link to kegg annotations (AT1G53290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464903.1) |
Pfam | Galactosyltransferase (PF01762.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer