Protein coding transcript 241297

• Transcript: Ll_transcript_257989
• CDS coordinates: 1844-2902 (+)
• Peptide sequence: MDEEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGAIAGAASRTATAPLDRLKVVLQVQTGSASIMSAAMNIWKQDGLLGFFRGNGLNVVKVAPESAIKFYAYEMLKNVIGEAQGNKSADIGTAGRLVAGGMAGAVAQMAIYPMDLIKTRLQTCASDGGRVPKLGRLTKDIWVHEGPRAFYRGLVPSLLGMIPYAGIDLTAYDTLKDMSKRYILDREPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQPCNSSNAYKGMSDVFWKTLKDEGFRGFYKGLIPNLLKVVPAASITYMVYENMKKNLDLD*
• ORF Type: complete

Annotations of Ll_transcript_257989

• Blastp: Calcium-binding mitochondrial carrier protein SCaMC-2-B from Danio with 42.46% of identity
• Blastx: Calcium-binding mitochondrial carrier protein SCaMC-2-B from Danio with 42.38% of identity
• Eggnog: Solute carrier family 25 (Mitochondrial carrier(ENOG410XQ4P)
• Kegg: Link to kegg annotations (569227)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463607.1)
• Pfam: EF hand (PF13202.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;