Transcript | Ll_transcript_257977 |
---|---|
CDS coordinates | 1799-2857 (+) |
Peptide sequence | MDEEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGAIAGAASRTATAPLDRLKVVLQVQTGSASIMSAAMNIWKQDGLLGFFRGNGLNVVKVAPESAIKFYAYEMLKNVIGEAQGNKSADIGTAGRLVAGGMAGAVAQMAIYPMDLIKTRLQTCASDGGRVPKLGRLTKDIWVHEGPRAFYRGLVPSLLGMIPYAGIDLTAYDTLKDMSKRYILDREPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQPCNSSNAYKGMSDVFWKTLKDEGFRGFYKGLIPNLLKVVPAASITYMVYENMKKNLDLD* |
ORF Type | complete |
Blastp | Calcium-binding mitochondrial carrier protein SCaMC-2-B from Danio with 42.46% of identity |
---|---|
Blastx | Calcium-binding mitochondrial carrier protein SCaMC-2-B from Danio with 42.38% of identity |
Eggnog | Solute carrier family 25 (Mitochondrial carrier(ENOG410XQ4P) |
Kegg | Link to kegg annotations (569227) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463607.1) |
Pfam | EF hand (PF13202.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer