Transcript | Ll_transcript_257998 |
---|---|
CDS coordinates | 494-1363 (+) |
Peptide sequence | MSGAIDMDHVGFSKSTAAPAAGHGKKTGPVSMDHVLLALRETKEERDIRIRSLFNFFDAVNNGYLDYAQIEAGLSALQIPPEYKYAKELFKVCDGDRDGRVDYGDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEMDEEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGGIAGAASRTATAPLDRLKVVLQVQSERAFIMPAIMKIWKQDGLLGFFRGNGLNVVKVAPESAIKFY |
ORF Type | 3prime_partial |
Blastp | Calcium-binding mitochondrial carrier protein SCaMC-1 from Mus with 33.86% of identity |
---|---|
Blastx | Calcium-binding mitochondrial carrier protein SCaMC-1 from Mus with 33.86% of identity |
Eggnog | Solute carrier family 25 (Mitochondrial carrier(ENOG410XQ4P) |
Kegg | Link to kegg annotations (229731) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463067.1) |
Pfam | EF-hand domain pair (PF13499.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer