Protein coding transcript 241307

• Transcript: Ll_transcript_257999
• CDS coordinates: 389-1258 (+)
• Peptide sequence: MSGAIDMDHVGFSKSTAAPAAGHGKKTGPVSMDHVLLALRETKEERDIRIRSLFNFFDAVNNGYLDYAQIEAGLSALQIPPEYKYAKELFKVCDGDRDGRVDYGDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEMDEEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGGIAGAASRTATAPLDRLKVVLQVQSERAFIMPAIMKIWKQDGLLGFFRGNGLNVVKVAPESAIKFY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_257999

• Blastp: Calcium-binding mitochondrial carrier protein SCaMC-1 from Mus with 33.86% of identity
• Blastx: Calcium-binding mitochondrial carrier protein SCaMC-1 from Mus with 33.86% of identity
• Eggnog: Solute carrier family 25 (Mitochondrial carrier(ENOG410XQ4P)
• Kegg: Link to kegg annotations (229731)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463067.1)
• Pfam: EF-hand domain pair (PF13499.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;