Protein coding transcript 241410

• Transcript: Ll_transcript_259757
• CDS coordinates: 644-1183 (+)
• Peptide sequence: MVYKSGTVQKMKDDAELMYKMLGDSMGKTCKPSFSQCCFCGGHTNSFKKISNEMDSIHGRTGYSDRHIDGRKKECAAAFVFFKNRYAALMAAQNLQTSNPMLWVTDLAPEPNDVYWSNLCIPYRQLWIRKIATVVASSTFMLVFLIPVTFAQGLTQLDKLEKMFPFLTEILQIGGFYFP*
• ORF Type: complete

Annotations of Ll_transcript_259757

• Blastp: CSC1-like protein RXW8 from Arabidopsis with 57.71% of identity
• Blastx: CSC1-like protein RXW8 from Arabidopsis with 55.12% of identity
• Eggnog: transmembrane protein 63C(COG5594)
• Kegg: Link to kegg annotations (AT1G58520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416621.1)
• Pfam: Cytosolic domain of 10TM putative phosphate transporter (PF14703.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;