Protein coding transcript 241468

• Transcript: Ll_transcript_258261
• CDS coordinates: 186-647 (+)
• Peptide sequence: MKIIDRKKNIFKLSQGEYVAVENLENIYGQVSIVESIWVYGNSFESFLVAVVNPRKQALEQWAQENAIKADDFDSLCQDSRTNRYIIDELTKIGRGKKLKGFELIKAVHLDPVPFDMERDLITPTYKKKRPQLLKYYQSTIDNMYKTINKSSA*
• ORF Type: complete

Annotations of Ll_transcript_258261

• Blastp: Long chain acyl-CoA synthetase 4 from Arabidopsis with 69.93% of identity
• Blastx: Long chain acyl-CoA synthetase 4 from Arabidopsis with 62.15% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG1022)
• Kegg: Link to kegg annotations (AT4G23850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420386.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;