Protein coding transcript 241534

• Transcript: Ll_transcript_258556
• CDS coordinates: 1507-2169 (+)
• Peptide sequence: MQFDAAYARWLEEHNRQINELMAAVNSHAGDIELRTIVDNVMTQFDEIFRLKGIAAKADVFHILSGMWKTPAERCFIWIGDFRSSELLKLLANQLEPLSEQQLMGIYNLQQSSQEAEDALSQGMDALQQSLAETLANGAPGPSGSSGNVANYMGQMAVAMGKLGTLEGFLRQADNLRQQTLQQMLRILTTRQSARALLAISDYFSRLRALSSLWLARPRD*
• ORF Type: complete

Annotations of Ll_transcript_258556

• Blastp: TGACG-sequence-specific DNA-binding protein TGA-2.1 from Nicotiana with 82.27% of identity
• Blastx: Transcription factor TGAL1 from Oryza sativa with 79.86% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107782457)
• CantataDB: Link to cantataDB annotations (CNT0000777)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429722.1)
• Pfam: Seed dormancy control (PF14144.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;