Protein coding transcript 241537

• Transcript: Ll_transcript_258564
• CDS coordinates: 2-346 (+)
• Peptide sequence: GIAAKADVFHILSGMWKTPAERCFMWIGGFRSSELLKLLVSQLEPLTEQQVMGVYNLQQSSQQAEDALSQGMDALQQSLAETLANGSPSPSGSSGNVANYMGQMAVAMGKLGTLE
• ORF Type: internal

Annotations of Ll_transcript_258564

• Blastp: TGACG-sequence-specific DNA-binding protein TGA-2.1 from Nicotiana with 88.7% of identity
• Blastx: TGACG-sequence-specific DNA-binding protein TGA-2.1 from Nicotiana with 88.7% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107782457)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437061.1)
• Pfam: Seed dormancy control (PF14144.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;