Transcript | Ll_transcript_258548 |
---|---|
CDS coordinates | 1507-2079 (+) |
Peptide sequence | MQFDAAYARWLEEHNRQINELMAAVNSHAGDIELRTIVDNVMTQFDEIFRLKGIAAKADVFHILSGMWKTPAERCFIWIGDFRSSELLKLLANQLEPLSEQQLMGIYNLQQSSQEAEDALSQGMDALQQSLAETLANGAPGPSGSSGNVANYMGQMAMAMGKLGTLEGFLHQVINCVCFRSNSLVSSFIL* |
ORF Type | complete |
Blastp | TGACG-sequence-specific DNA-binding protein TGA-2.1 from Nicotiana with 79.43% of identity |
---|---|
Blastx | Transcription factor HBP-1b(c38) from Triticum with 74.81% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107782457) |
CantataDB | Link to cantataDB annotations (CNT0000777) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429722.1) |
Pfam | Seed dormancy control (PF14144.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer