Protein coding transcript 2416

• Transcript: Ll_transcript_428115
• CDS coordinates: 3-653 (+)
• Peptide sequence: NEKSVMELHDLPGGAKAFLLVAKFCYGVKMELNPSNVVILRCAAEYLQMTEDYGEGNLILHTENFLNHIFGYWTDTLKALKTCEEVLPFAEELHITSRCIHSLVVKAADPSLAIWPVSSQSVAQSPEDAEMWNGISLTSKASGEDWWFGDVSSLSLPLYKRFIQGSSARHMRPERIAGSLVYYAKKHIPLLVNQSTSHNGNSFAFKSTPSTPCEADQ
• ORF Type: internal

Annotations of Ll_transcript_428115

• Blastp: BTB/POZ domain-containing protein At5g03250 from Arabidopsis with 57.58% of identity
• Blastx: BTB/POZ domain-containing protein At5g03250 from Arabidopsis with 57.58% of identity
• Eggnog: BTB POZ domain-containing protein(ENOG410YCM9)
• Kegg: Link to kegg annotations (AT5G03250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434035.1)
• Pfam: NPH3 family (PF03000.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;