Protein coding transcript 241662

• Transcript: Ll_transcript_260326
• CDS coordinates: 3-419 (+)
• Peptide sequence: QGNLAINVRRLPSVKLPGEKDGKIWMWHRCLRCPHVDGVPPATQRVIMSDAAWGLSFGKFLELSFSNHATANRVASCGHSLQRDCLRFYGFGSMVAFFRYSPVDVLSVHLPPSVLEFGHIQEEWIRKEAGEVILTYYF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_260326

• Blastp: Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C from Arabidopsis with 83.58% of identity
• Blastx: Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C from Arabidopsis with 83.58% of identity
• Eggnog: Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity)(COG0459)
• Kegg: Link to kegg annotations (AT1G71010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432380.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;