Protein coding transcript 241748

• Transcript: Ll_transcript_259948
• CDS coordinates: 3502-3861 (+)
• Peptide sequence: MRGVYFKNMKWQAAIKVDKKQIHLGTVGSQEEAAHLYDRAAFMCGREPNFELPEEEKRELRNFKWDEFLAMTRHAITRKKHKRRLSPGSLNNLELPPLNKDDSDTKQVFSPCEDAEKET*
• ORF Type: complete

Annotations of Ll_transcript_259948

• Blastp: Ethylene-responsive transcription factor-like protein At4g13040 from Arabidopsis with 75.29% of identity
• Blastx: Ethylene-responsive transcription factor-like protein At4g13040 from Arabidopsis with 76.92% of identity
• Eggnog: AP2 domain containing protein, expressed(ENOG4111S5C)
• Kegg: Link to kegg annotations (AT4G13040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461436.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;