Transcript | Ll_transcript_259953 |
---|---|
CDS coordinates | 2313-2672 (+) |
Peptide sequence | MRGVYFKNMKWQAAIKVDKKQIHLGTVGSQEEAAHLYDRAAFMCGREPNFELPEEEKRELRNFKWDEFLAMTRHAITRKKHKRRLSPGSLNNLELPPLNKDDSDTKQVFSPCEDAEKET* |
ORF Type | complete |
Blastp | Ethylene-responsive transcription factor-like protein At4g13040 from Arabidopsis with 75.29% of identity |
---|---|
Blastx | Ethylene-responsive transcription factor-like protein At4g13040 from Arabidopsis with 76.92% of identity |
Eggnog | AP2 domain containing protein, expressed(ENOG4111S5C) |
Kegg | Link to kegg annotations (AT4G13040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461439.1) |
Pfam | AP2 domain (PF00847.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer