Transcript | Ll_transcript_389953 |
---|---|
CDS coordinates | 477-1376 (+) |
Peptide sequence | MLTAVRKLQVSTERLTPLHPEFLLLCLLSKCYKTGLAILDDDIFEVDQPRDLFLFFYYGGMICIGQKRFQKALDLLHNVVTAPMSSLNAIAVEAYKKYILVSLIRHGQFSTNLPKYSSSVAQRNLKNFCQPYIELANSYGTGKIAELEEYVQTNTHKFESDNNLGLVKQVVSSMYKRNIQRLTQTYLTLSLQDIANTVQLNSPKDAEMHVLQMIQDGEIYAMINQKDGMVSFLEDPEQYKTCEMIEHIDSSIQRVMALSRKLATVDEQISCDPIYLSKVGRERQRYDFDDFDVPQKFNI* |
ORF Type | complete |
Blastp | COP9 signalosome complex subunit 3 from Arabidopsis with 69.77% of identity |
---|---|
Blastx | COP9 signalosome complex subunit 3 from Arabidopsis with 59.43% of identity |
Eggnog | COP9 (constitutive photomorphogenic) homolog, subunit 3 (Arabidopsis(ENOG410XRKY) |
Kegg | Link to kegg annotations (AT5G14250) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427626.1) |
Pfam | PCI domain (PF01399.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer