Protein coding transcript 24197

• Transcript: Ll_transcript_389954
• CDS coordinates: 1233-1613 (+)
• Peptide sequence: MYKRNIQRLTQTYLTLSLQDIANTVQLNSPKDAEMHVLQMIQDGEIYAMINQKDGMVSFLEDPEQYKTCEMIEHIDSSIQRVMALSRKLATVDEQISCDPIYLSKVGRERQRYDFDDFDVPQKFNI*
• ORF Type: complete

Annotations of Ll_transcript_389954

• Blastp: COP9 signalosome complex subunit 3 from Arabidopsis with 74.22% of identity
• Blastx: COP9 signalosome complex subunit 3 from Arabidopsis with 71.35% of identity
• Eggnog: COP9 (constitutive photomorphogenic) homolog, subunit 3 (Arabidopsis(ENOG410XRKY)
• Kegg: Link to kegg annotations (AT5G14250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427626.1)
• Pfam: PCI domain (PF01399.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;