Protein coding transcript 24211

• Transcript: Ll_transcript_391275
• CDS coordinates: 354-935 (+)
• Peptide sequence: MADREDEDLEMAIRMSMHHAPPEPKRSKPRHSSVAVGVVSGTPEESVEAKSRRIKRELMAAAAEKRMAAVATSRSNLPAADKGGGEIGRREEEEEERMAMAMRNSPSAITGGGEVGRRKEEEGEGLMSVEEANKLFVIVFGNEVSKEILAQWSNQGIRFSSDPETSMGLVQHEGGPCGVLAAIQVMVHFSAAL*
• ORF Type: complete

Annotations of Ll_transcript_391275

• Blastp: Probable ubiquitin carboxyl-terminal hydrolase MINDY-4 from Homo with 26.86% of identity
• Blastx: -
• Eggnog: family with sequence similarity 188, member(ENOG410XSGV)
• Kegg: Link to kegg annotations (84182)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413527.1)
• Pfam: Ubiquitin interaction motif (PF02809.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;