Transcript | Ll_transcript_391275 |
---|---|
CDS coordinates | 354-935 (+) |
Peptide sequence | MADREDEDLEMAIRMSMHHAPPEPKRSKPRHSSVAVGVVSGTPEESVEAKSRRIKRELMAAAAEKRMAAVATSRSNLPAADKGGGEIGRREEEEEERMAMAMRNSPSAITGGGEVGRRKEEEGEGLMSVEEANKLFVIVFGNEVSKEILAQWSNQGIRFSSDPETSMGLVQHEGGPCGVLAAIQVMVHFSAAL* |
ORF Type | complete |
Blastp | Probable ubiquitin carboxyl-terminal hydrolase MINDY-4 from Homo with 26.86% of identity |
---|---|
Blastx | - |
Eggnog | family with sequence similarity 188, member(ENOG410XSGV) |
Kegg | Link to kegg annotations (84182) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413527.1) |
Pfam | Ubiquitin interaction motif (PF02809.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer