Protein coding transcript 2422

• Transcript: Ll_transcript_428043
• CDS coordinates: 177-767 (+)
• Peptide sequence: MAAATSAMAALQSSMTSLSLSSNSFFGQRLSPISLSPLLSKSVEKQCPIVMKLKRWERKKCKPNSLPLLHKMHVKVGDTVKVISGHEKGKVGEISQLFKHNSTVIVKEINLKTKHVKSKEEGEPGQIIKIEGPIHSSNVMLYSKEQNVASRVGHKVLDNGKRVRYLIKTGEIIDSAENWKKLTEDDKKTEEVAVSA*
• ORF Type: complete

Annotations of Ll_transcript_428043

• Blastp: 50S ribosomal protein L24, chloroplastic from Nicotiana with 73.68% of identity
• Blastx: 50S ribosomal protein L24, chloroplastic from Nicotiana with 78.34% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458848.1)
• Pfam: KOW motif (PF00467.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;