Transcript | Ll_transcript_135049 |
---|---|
CDS coordinates | 230-799 (+) |
Peptide sequence | MPKRTTHTYSSEDAAPEGPNSDLFVYYCKHCGSHVLITDTQLQKMPKRKTDKSYVLDKSKHLARFNINDAGNVLLKRGQGKLEKQFRMNCIGCGLFVCYRSQPDFESSSFIYVLDGSLSTVAAETNPQDAPVPPCISQLEGGLVQVAIEVEDRAQRSAITSDFSLLYFNFDFIFMFLAYVMFLELCYLS* |
ORF Type | complete |
Blastp | UPF0235 protein At5g63440 from Arabidopsis with 82.5% of identity |
---|---|
Blastx | UPF0235 protein At5g63440 from Arabidopsis with 82.5% of identity |
Eggnog | Uncharacterised ACR, YggU family COG1872(ENOG41123AI) |
Kegg | Link to kegg annotations (AT5G63440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441576.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer