Protein coding transcript 242377

• Transcript: Ll_transcript_135486
• CDS coordinates: 252-587 (+)
• Peptide sequence: MATLSSSTKDNKNQNGMVVKNPIAHDENVLQKHVAFFDRNHDGIIYPSETFRGFRAIGCGILLSTVAAIFINTSLSQKTRPVFIFFTLQHLLFSYILNLIQHAMRKDIENI*
• ORF Type: complete

Annotations of Ll_transcript_135486

• Blastp: Probable peroxygenase 5 from Arabidopsis with 76.27% of identity
• Blastx: Probable peroxygenase 5 from Arabidopsis with 76.27% of identity
• Eggnog: Caleosin related protein(ENOG410YGB5)
• Kegg: Link to kegg annotations (AT1G70680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433897.1)
• Pfam: Caleosin related protein (PF05042.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;