Transcript | Ll_transcript_135501 |
---|---|
CDS coordinates | 246-626 (+) |
Peptide sequence | MRKWTLPSILLLLSLLLLFSDQGQKLKANAEANSEELVDPPKVEDKIGAVPHGLSTDSDVAKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDVNSFSFILCLLV* |
ORF Type | complete |
Blastp | Endoplasmin homolog from Catharanthus with 80.87% of identity |
---|---|
Blastx | Endoplasmin homolog from Catharanthus with 81.58% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453253.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer