Protein coding transcript 242521

• Transcript: Ll_transcript_135502
• CDS coordinates: 1152-2507 (+)
• Peptide sequence: MTKEDLIKNLGTIAKSGTSAFVEKMQTSGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQYVWESKADGAFAISEDTWNEPLGRGTEIRLHLKDEAGEYLEESKLKELVKRYSEFINFPIYIWASKEVDVEVPADEDDSSNEDESSESRSPEEESEEAADESGDEEKKPKTKTVKETTYEWELLNDVKAIWLRNPKEVTDEEYTKFYHSLAKDLSDDKPLAWSHFIAEGDVEFKAVLFVPPKAPHDLYESYYNSNKSNLKLFVRRVFISDEFDELLPKYLNFLKGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRRIAEEDPDESSDKEKKEEVSSKNDEKRGQYAKFWNEFGKSIKLGIIEDATNRNRLAKLLRFESTKSEGKLTSLDQYISRMKAGQKDIFYITGTNKEQLEKSPFLERLKKKNFEVQIKSFPFYAKDF*
• ORF Type: complete

Annotations of Ll_transcript_135502

• Blastp: Endoplasmin homolog from Catharanthus with 85.87% of identity
• Blastx: Endoplasmin homolog from Catharanthus with 81.55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453253.1)
• Pfam: Hsp90 protein (PF00183.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;