Protein coding transcript 242524

• Transcript: Ll_transcript_135505
• CDS coordinates: 1152-2186 (+)
• Peptide sequence: MTKEDLIKNLGTIAKSGTSAFVEKMQTSGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQYVWESKADGAFAISEDTWNEPLGRGTEIRLHLKDEAGEYLEESKLKELVKRYSEFINFPIYIWASKEVDVEVPADEDDSSNEDESSESRSPEEESEEAADESGDEEKKPKTKTVKETTYEWELLNDVKAIWLRNPKEVTDEEYTKFYHSLAKDLSDDKPLAWSHFIAEGDVEFKAVLFVPPKAPHDLYESYYNSNKSNLKLFVRRVFISDEFDELLPKYLNFLKGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRRIAEEDPDESSDKEKKGMV*
• ORF Type: complete

Annotations of Ll_transcript_135505

• Blastp: Endoplasmin homolog from Hordeum with 84.12% of identity
• Blastx: Endoplasmin homolog from Catharanthus with 87.4% of identity
• Eggnog: Molecular chaperone. Has ATPase activity (By similarity)(COG0326)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453253.1)
• Pfam: Hsp90 protein (PF00183.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;