Transcript | Ll_transcript_134887 |
---|---|
CDS coordinates | 266-871 (+) |
Peptide sequence | MTQRMILTQEEMEELVLKRCWLARYWGLAVKHGLCPDTAPSKHGYWSSLAPLPFEVVTSAGQKAREKPLDKNADNPYRSNPIRDLNDLTGEGSIESMLSVEMGLRELASLKVEDAVVLALAQYRHPNLDSKYPGDPKFVEALELSDEEVEDVVFKEAWLTYFWRRALTYGVEVDIAEERLRFWISRSGKSPTSHDAIDGKL* |
ORF Type | complete |
Blastp | Coiled-coil domain-containing protein SCD2 from Arabidopsis with 67.48% of identity |
---|---|
Blastx | Coiled-coil domain-containing protein SCD2 from Arabidopsis with 67.76% of identity |
Eggnog | NA(ENOG410ZI6D) |
Kegg | Link to kegg annotations (AT3G48860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462869.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer