Protein coding transcript 242710

• Transcript: Ll_transcript_136208
• CDS coordinates: 131-862 (+)
• Peptide sequence: MQASIACSSLPHRNIVLPPTLSPKPNSTFTFLSLTKSSSYFTPRCTFQPQPLQISSPPSKSVRVSRSKVTPLLCGISSNGYSANEGRSIREWVEVVGDAISTAFPLWVTIGCVLGLMKPNSFNWVTPQMNMVGLIIVMLGMGMTLSLEDLRGALSMPKEVLSGFFLQYSVMPLSGYFISKLLNLPPHYAAGLILVGCCPGGTASNIVTYLARGNVALSVIMTAASTVSAVVSPLFVFFFDVQL*
• ORF Type: complete

Annotations of Ll_transcript_136208

• Blastp: Probable sodium/metabolite cotransporter BASS1, chloroplastic from Arabidopsis with 67.19% of identity
• Blastx: Probable sodium/metabolite cotransporter BASS1, chloroplastic from Arabidopsis with 72.35% of identity
• Eggnog: bile acid(COG0385)
• Kegg: Link to kegg annotations (AT1G78560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456961.1)
• Pfam: SBF-like CPA transporter family (DUF4137) (PF13593.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;