Transcript | Ll_transcript_136216 |
---|---|
CDS coordinates | 902-1273 (+) |
Peptide sequence | MSELSKLAGEWEEVAIIICIFLVGFCGTYLKFYPSMKAYEYGLRVFLITYCIVIVSGNRTGDFINPARNRFLLIALGAAVSLSVNIFIYPIWAGEDLHALVAKNFIGVASSLEGVVNSYLNCIE |
ORF Type | 3prime_partial |
Blastp | Aluminum-activated malate transporter 9 from Arabidopsis with 66.94% of identity |
---|---|
Blastx | Aluminum-activated malate transporter 9 from Arabidopsis with 67.57% of identity |
Eggnog | aluminum-activated malate transporter(ENOG410XR8V) |
Kegg | Link to kegg annotations (AT3G18440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436674.1) |
Pfam | Aluminium activated malate transporter (PF11744.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer