Transcript | Ll_transcript_136241 |
---|---|
CDS coordinates | 1119-1550 (+) |
Peptide sequence | MLLWQKNFNGVASSLEGVVNSYLNCIEYERVPSKILTYQASDDPVYSGYRSVVESTSKEDALLGFAVWEPPHGRYKMLRYPWKNYVKVSGALRHCAFMVMAMHGCILSEIQAPPEKRQVFRNELKKVCSEGAKVLREIGNKVKK |
ORF Type | 3prime_partial |
Blastp | Aluminum-activated malate transporter 4 from Arabidopsis with 76.98% of identity |
---|---|
Blastx | Aluminum-activated malate transporter 9 from Arabidopsis with 74.82% of identity |
Eggnog | aluminum-activated malate transporter(ENOG410XR8V) |
Kegg | Link to kegg annotations (AT1G25480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436674.1) |
Pfam | Aluminium activated malate transporter (PF11744.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer