Protein coding transcript 242738

• Transcript: Ll_transcript_136223
• CDS coordinates: 943-1422 (+)
• Peptide sequence: MCISISFSLTMLAGSTFSKGLNRAAGTLSAAGIALGMSELSKLAGEWEEVAIIICIFLVGFCGTYLKFYPSMKAYEYGLRVFLITYCIVIVSGNRTGDFINPARNRFLLIALGAAVSLSVNIFIYPIWAGEDLHALVAKNFIGVASSLEGVVNSYLNCIE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_136223

• Blastp: Aluminum-activated malate transporter 9 from Arabidopsis with 63.75% of identity
• Blastx: Aluminum-activated malate transporter 9 from Arabidopsis with 63.75% of identity
• Eggnog: aluminum-activated malate transporter(ENOG410XR8V)
• Kegg: Link to kegg annotations (AT3G18440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436674.1)
• Pfam: Fusaric acid resistance protein-like (PF13515.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;