Protein coding transcript 242775

• Transcript: Ll_transcript_136149
• CDS coordinates: 1164-1742 (+)
• Peptide sequence: MTKQPPTQELVAKDLHANEWQFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVMSSHSMNLGVLATAWHAISTGTMFTVYYKPRTSPAEFIVPYNQYMESLKNRYTIGMRFKMRFEGEEAPEQRFTGTVVGIEDSDAKTWPDSKWRSLKVVSSVFVELCVTVK*
• ORF Type: complete

Annotations of Ll_transcript_136149

• Blastp: Auxin response factor 2 from Arabidopsis with 90.5% of identity
• Blastx: Auxin response factor 2B from Lycopersicon with 87.17% of identity
• Eggnog: auxin response factor(ENOG4110RNJ)
• Kegg: Link to kegg annotations (AT5G62000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416907.1)
• Pfam: B3 DNA binding domain (PF02362.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;