Protein coding transcript 242810

• Transcript: Ll_transcript_134311
• CDS coordinates: 102-1157 (+)
• Peptide sequence: MAKKQKSSSSVPPLPPSRDETSSDHQQNHSHDSQDASSDDQFVKSPSKIPQSDSGSESDSDTTPPPSTSKSIPSKPIDTSSLKRPANDIDSKRVKKKGTYESEEEAKKAVVDSRKLFQRLWSEEDEIAILKGMVEFTSKTGKDPYRYAEAFYEFVKKSLHVEASSNQLKEKIRRLKKKFENNAHRGKNGEDPNFSKQFDRETFELSKKVWGNAGSGGVENVVKGKSDRKVVETPKKELARSNDVAPSKPKPELKWDSRLVDLNKDVKMDIDVDTSSYLMEVFRVNKGVGLSELNEEVVKRGLELIGASEREEFEEEWKKLQAAEFELSVKRVELIANHARLILEACKSSNH*
• ORF Type: complete

Annotations of Ll_transcript_134311

• Blastp: GLABROUS1 enhancer-binding protein-like from Arabidopsis with 36.84% of identity
• Blastx: GLABROUS1 enhancer-binding protein-like from Arabidopsis with 36.36% of identity
• Eggnog: Protein of unknown function, DUF573(ENOG410YYUR)
• Kegg: Link to kegg annotations (AT4G25210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439219.1)
• Pfam: Protein of unknown function, DUF573 (PF04504.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;