Protein coding transcript 242895

• Transcript: Ll_transcript_134422
• CDS coordinates: 3-575 (+)
• Peptide sequence: QHRNYYKFSILVIYAPLRGLHCICLRCSLFMAASLSTVAAVNRTPVNFNGTVAGPVPSSSFFGNNLKKVISRLPNTKVSSGSFKVVAVEEIDPKKQTDKDRWRGLAYDISDDQQDITRGKGMVDSLFQAPQDAGTHYAVMNSYDYISGGLRQYHLDNTLDGLYIAPAFMDKLVVHITKNFMTLPNIKAWN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_134422

• Blastp: Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic from Vigna with 73.75% of identity
• Blastx: Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic from Vigna with 73.75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419039.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;