Transcript | Ll_transcript_290424 |
---|---|
CDS coordinates | 236-751 (+) |
Peptide sequence | MALSNNVIGAINFIAVLLSIPIIGAGIWLTNGAADSCVKFLQWPLIILGVLILIVALAGFIGAFWRIQCLLIFYLIAMLVLIILLVCLVVFVYMVTIRGHGIIEPNRAYLEYHMDDFSGFLRRRVRSSFKWDGIRSCLSQTNMCAELNQSFRMAQDFFNAHLTPMQVKLTC* |
ORF Type | complete |
Blastp | Protein TORNADO 2 from Arabidopsis with 71.69% of identity |
---|---|
Blastx | Protein TORNADO 2 from Arabidopsis with 71.69% of identity |
Eggnog | Tetraspanin family(ENOG410YAS0) |
Kegg | Link to kegg annotations (AT5G46700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445306.1) |
Pfam | Tetraspanin family (PF00335.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer