Protein coding transcript 2429

• Transcript: Ll_transcript_290424
• CDS coordinates: 236-751 (+)
• Peptide sequence: MALSNNVIGAINFIAVLLSIPIIGAGIWLTNGAADSCVKFLQWPLIILGVLILIVALAGFIGAFWRIQCLLIFYLIAMLVLIILLVCLVVFVYMVTIRGHGIIEPNRAYLEYHMDDFSGFLRRRVRSSFKWDGIRSCLSQTNMCAELNQSFRMAQDFFNAHLTPMQVKLTC*
• ORF Type: complete

Annotations of Ll_transcript_290424

• Blastp: Protein TORNADO 2 from Arabidopsis with 71.69% of identity
• Blastx: Protein TORNADO 2 from Arabidopsis with 71.69% of identity
• Eggnog: Tetraspanin family(ENOG410YAS0)
• Kegg: Link to kegg annotations (AT5G46700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445306.1)
• Pfam: Tetraspanin family (PF00335.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;