Protein coding transcript 242900

• Transcript: Ll_transcript_134437
• CDS coordinates: 123-788 (+)
• Peptide sequence: MIMCLRYNLDNTKDGFYIAPAFMDKLVVHVTKNFMTLPNIKVPLILGIWGGKGQGKSFQCELVFSKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCALFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEDNPRVPIVVTGNDFSTLYAPLIRDGRMEKFYWAPTRDDRIGVCKGIFRSDNIAEDDIVKIVDTF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_134437

• Blastp: Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic from Larrea with 92.17% of identity
• Blastx: Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic from Larrea with 92.17% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419039.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;