Protein coding transcript 242905

• Transcript: Ll_transcript_134441
• CDS coordinates: 240-833 (+)
• Peptide sequence: MAATVGNVTVTKLNLNGSGAGASVQSSAFFGSNLKKITSRLPNTKVSCGSFKVVAAEEIDPKKQTDTDRWKGLAYDISDDQQDITRGKGMVDSLFQAPSGAGTHYAVMNSYDYISGGLRQYHLDNTLDGLYIAPAFMDKLVVHITKNFMTLPNIKVPLILGIWGGKGQGKSFQCELVFSKMGIKCVIAILAPPKINV*
• ORF Type: complete

Annotations of Ll_transcript_134441

• Blastp: Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic from Vigna with 76.47% of identity
• Blastx: Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic from Larrea with 90.96% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002861)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433087.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;