Protein coding transcript 242909

• Transcript: Ll_transcript_134425
• CDS coordinates: 50-385 (+)
• Peptide sequence: MDKLVVHITKNFMTLPNIKVPLILGVWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIIKKGKMCALFINDLDAGAGRMGGTTQYTVNNQM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_134425

• Blastp: Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic from Oryza sativa with 97.32% of identity
• Blastx: Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic from Larrea with 92.97% of identity
• Eggnog: 26S protease regulatory subunit(COG1222)
• Kegg: Link to kegg annotations (4351224)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433087.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;