Protein coding transcript 242913

• Transcript: Ll_transcript_134429
• CDS coordinates: 238-801 (+)
• Peptide sequence: MAASLSTVGAVNVTLLSLNGSGAGASVPSSAFFGSNLKKVTSRLPDTKASSGSFKIVAVEEIDPKKQTDQDRWKGLAYDISDDQQDITRGKGMVDSLFQAPADAGTHYAVMNSYEYISTGLREYNLDNNMGGFYIAPAFMDKLVVHITKNFMTLPNIKVPLILGVWGGKGQGKSFQCELVFAKMGIK*
• ORF Type: complete

Annotations of Ll_transcript_134429

• Blastp: Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic from Vigna with 80.32% of identity
• Blastx: Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic from Larrea with 94.3% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002861)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461023.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;